회사 세부 사항
  • Taizhou Volsen Chemical Co., Ltd.

  •  [Zhejiang,China]
  • 회사유형:제조사
  • Main Mark: 미주 , 아시아 , 동유럽 , 유럽 , 북유럽 , 기타 시장 , 서유럽 , 세계적인
  • 수출업자:91% - 100%
  • 인증서 표시:GS, CE, ISO9001, ISO14000
  • 기술:부갑상선 호르몬 단편 52232-67-4,부갑상선 호르몬 단편 CAS 52232-67-4,PTH 1-34 인간
Taizhou Volsen Chemical Co., Ltd. 부갑상선 호르몬 단편 52232-67-4,부갑상선 호르몬 단편 CAS 52232-67-4,PTH 1-34 인간
홈페이지 > 제품 리스트 > 펩타이드 제품 > 부갑상선 호르몬 단편 (1-34) (CAS 52232-67-4)

부갑상선 호르몬 단편 (1-34) (CAS 52232-67-4)

공유:  
    단가: USD 1 / Kilogram
    지불 유형: T/T
    Incoterm: CIF
    최소 주문량: 1 Kilogram
    배송 시간: 15 일

기본 정보

모형: 52232-67-4

Additional Info

포장: 필요에 따라

생산력: KGS

상표: 찬송가

수송: Air

원산지: 중국

공급 능력: TRUE MANUFACTURER

인증 : GMP Peptide

제품 설명


우리는 포스테오 아세테이트 중 하나입니다

중국 시장에서 CAS 52232-67-4 공급 업체. Teriparatide는 부갑상선 호르몬의 재조합 형태입니다. 일부 형태의 골다공증 치료에 사용되는 효과적인 동화 작용 (즉, 뼈 성장) 제제이며 때로는 골절 치료를 가속화하기 위해 오프 라벨을 사용합니다. Teriparatide Acetate 52232-67-4는 빠른 동작, 안정된 품질 및 고순도로 잘 알려져 있습니다. 우리는 많은 고객들로부터 협조를 얻었습니다.



테라. 고양이 egory : 제약 펩타이드

아니 카스 :. 52232-67-4

동의어 : 부갑상선 호르몬의 인간 : FRAGMENT 1-34; 부갑상선 호르몬 (인간 1-34); 부갑상선 호르몬 (1-34) HUMAN; PTH (1-34) (인간); PTH (HUMAN, 1-34); 포스테오; 포스테오 아세테이트; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

52232-67-4

분자식 : C172H278N52O47S2

분자량 : 3890.49792

순도 : ≥98 %

포장 : 수출 가치 포장

물질 안전 보건 자료 (MSDS) : 요청에 사용 가능

사용법 : 일부 형태의 골다공증 치료

제품 디렉토리 : 펩타이드 제품

제품이미지
  • 부갑상선 호르몬 단편 (1-34) (CAS 52232-67-4)
이 업체에게 이메일로 보내기
  • *제목:
  • *메시지:
    귀하의 메시지 20-8000 자 사이 여야합니다

모바일 웹사이트 색인. 사이트 맵


뉴스 레터 구독하기:
업데이트 받기, 특별 행사, 큰 상, 할인

다국어:
Copyright © 2019 Taizhou Volsen Chemical Co., Ltd.판권소유
공급 업체와 통신?공급 업체
Amy Cheng Ms. Amy Cheng
나는 당신을 위해 무엇을 할 수 있습니까?
지금 채팅 공급 업체에 문의하십시오