공급 업체와 통신? 공급 업체
Amy Cheng Ms. Amy Cheng
나는 당신을 위해 무엇을 할 수 있습니까?
지금 채팅 공급 업체에 문의하십시오
Taizhou Volsen Chemical Co., Ltd.
제품 리스트펩타이드 제품부갑상선 호르몬 단편 (1-34) (CAS 52232-67-4)
부갑상선 호르몬 단편 (1-34) (CAS 52232-67-4)
  • 부갑상선 호르몬 단편 (1-34) (CAS 52232-67-4)

부갑상선 호르몬 단편 (1-34) (CAS 52232-67-4)

    단가: USD 1 / Kilogram
    지불 유형: T/T
    Incoterm: CIF
    최소 주문량: 1 Kilogram
    배송 시간: 15 일

기본 정보

모형: 52232-67-4

Additional Info

포장: 필요에 따라

생산력: KGS

상표: 찬송가

수송: Air

원산지: 중국

공급 능력: TRUE MANUFACTURER

인증 : GMP Peptide

제품 설명


우리는 포스테오 아세테이트 중 하나입니다

중국 시장에서 CAS 52232-67-4 공급 업체. Teriparatide는 부갑상선 호르몬의 재조합 형태입니다. 일부 형태의 골다공증 치료에 사용되는 효과적인 동화 작용 (즉, 뼈 성장) 제제이며 때로는 골절 치료를 가속화하기 위해 오프 라벨을 사용합니다. Teriparatide Acetate 52232-67-4는 빠른 동작, 안정된 품질 및 고순도로 잘 알려져 있습니다. 우리는 많은 고객들로부터 협조를 얻었습니다.



테라. 고양이 egory : 제약 펩타이드

아니 카스 :. 52232-67-4

동의어 : 부갑상선 호르몬의 인간 : FRAGMENT 1-34; 부갑상선 호르몬 (인간 1-34); 부갑상선 호르몬 (1-34) HUMAN; PTH (1-34) (인간); PTH (HUMAN, 1-34); 포스테오; 포스테오 아세테이트; SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

52232-67-4

분자식 : C172H278N52O47S2

분자량 : 3890.49792

순도 : ≥98 %

포장 : 수출 가치 포장

물질 안전 보건 자료 (MSDS) : 요청에 사용 가능

사용법 : 일부 형태의 골다공증 치료

제품 디렉토리 : 펩타이드 제품

이 업체에게 이메일로 보내기
  • Amy ChengMs. Amy Cheng
  • 귀하의 메시지 20-8000 자 사이 여야합니다

관련 제품 목록